PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00027347-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 95aa    MW: 11606.3 Da    PI: 10.1465
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00027347-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.47.8e-093069445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        +T++E++l+++  ++ G + W++Ia +++ gR ++++  +w 
  WALNUT_00027347-RA 30 MTEQEEDLFYRMYRLVGER-WDLIAGRIP-GRKPEEIERFWI 69
                        69*****************.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00272674IPR001005SANT/Myb domain
CDDcd001671.29E-53068No hitNo description
PfamPF002496.6E-83069IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-73170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-83169IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MDRRRRKRAN ISSTFESEEV SSIEWEVIHM TEQEEDLFYR MYRLVGERWD LIAGRIPGRK  60
PEEIERFWIM RHWEGVAAGR RKLHKKESPR SVFSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413830.14e-38PREDICTED: transcription factor TRY-like
SwissprotQ8GV052e-38TRY_ARATH; Transcription factor TRY
TrEMBLM0TRZ14e-38M0TRZ1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P19880_0011e-37(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35832757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.14e-29MYB_related family protein